Nesprin 2 (SYNE2) (NM_182910) Human Mass Spec Standard

CAT#: PH313843

SYNE2 MS Standard C13 and N15-labeled recombinant protein (NP_878914)

Product Images

Coomassie blue staining of purified SYNE2 protein (Cat# TP313843). The protein was produced from HEK293T cells transfected with SYNE2 cDNA clone (Cat# RC213843) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213843
• Predicted MW: 48 kDa
• Protein Sequence:
  Sequence Link

  >RC213843 representing NM_182910
  Red=Cloning site Green=Tags(s)
  
  MEGDRNVPPVPPASSTPYKPPYGKLLLPPGTDGGKEGPRVLNGNPQQEDGGLAGITEQQSGAFDRWEMIQ
  AQELHNKLKIKQNLQQLNSDISAITTWLKKTEAELEMLKMAKPPSDIQEIELRVKRLQEILKAFDTYKAL
  VVSVNVSSKEFLQTESPESTELQSRLRQLSLLWEAAQGAVDSWRGGLRQSLMQCQGSKTRPRSDVLFFKD
  FHQLSQNLLLWLASAKNRRQKAHVTDPKADPRALLECRRELMQLEKELVERQPQVDMLQEISNSLLIKGH
  GEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRAKFRAVR
  TTEGEEETESRVPGSTRPQRSFLSRVVRAALPLQLLLLLLLLLACLLPSSEEDYSCTQANNFARSFYPML
  RYTNGPPPT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_878914
• RefSeq Size: 3103
• RefSeq ORF: 1287
• Synonyms: EDMD5; KASH2; Nesp2; Nesprin-2; NUA; NUANCE; SYNE-2; TROPH
• Locus ID: 23224
• UniProt ID: Q8WXH0
• Cytogenetics: 14q23.2
• Summary: The protein encoded by this gene is a nuclear outer membrane protein that binds cytoplasmic F-actin. This binding tethers the nucleus to the cytoskeleton and aids in the maintenance of the structural integrity of the nucleus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
• Protein Families: Druggable Genome, Transcription Factors