B3GNT6 (NM_138706) Human Mass Spec Standard

CAT#: PH314024

B3GNT6 MS Standard C13 and N15-labeled recombinant protein (NP_619651)

Product Images

Coomassie blue staining of purified B3GNT6 protein (Cat# TP314024). The protein was produced from HEK293T cells transfected with B3GNT6 cDNA clone (Cat# RC214024) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214024
• Predicted MW: 42.7 kDa
• Protein Sequence:
  Sequence Link

  >RC214024 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAFPCRRSLTAKTLACLLVGVSFLALQQWFLQAPRSPREERSPQEETPEGPTDAPAADEPPSELVPGPPC
  VANASANATADFEQLPARIQDFLRYRHCRHFPLLWDAPAKCAGGRGVFLLLAVKSAPEHYERRELIRRTW
  GQERSYGGRPVRRLFLLGTPGPEDEARAERLAELVALEAREHGDVLQWAFADTFLNLTLKHLHLLDWLAA
  RCPHARFLLSGDDDVFVHTANVVRFLQAQPPGRHLFSGQLMEGSVPIRDSWSKYFVPPQLFPGSAYPVYC
  SGGGFLLSGPTARALRAAARHTPLFPIDDAYMGMCLERAGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYR
  ELLLVHRFAPYEMLLMWKALHSPALSCDRGHRVS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_619651
• RefSeq Size: 2560
• RefSeq ORF: 1152
• Synonyms: 3-Gn-T6; B3Gn-T6; beta-1; beta3Gn-T6; BGnT-6
• Locus ID: 192134
• UniProt ID: Q6ZMB0, A8K9Q8
• Cytogenetics: 11q13.5
• Summary: The protein encoded by this gene is a beta-1,3-N-acetylglucosaminyltransferase that adds an N-acetylglucosamine moiety to N-acetylgalactosamine-modified serine or threonine. The encoded enzyme is responsible for creating the core 3 structure of O-glycans, which are important components of mucin-type glycoproteins. [provided by RefSeq, Dec 2016]
• Protein Pathways: Metabolic pathways, O-Glycan biosynthesis