NCR2 (NM_004828) Human Mass Spec Standard

CAT#: PH314084

NCR2 MS Standard C13 and N15-labeled recombinant protein (NP_004819)

Product Images

Coomassie blue staining of purified NCR2 protein (Cat# TP314084). The protein was produced from HEK293T cells transfected with NCR2 cDNA clone (Cat# RC214084) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214084
• Predicted MW: 30.5 kDa
• Protein Sequence:
  Sequence Link

  >RC214084 representing NM_004828
  Red=Cloning site Green=Tags(s)
  
  MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSS
  KPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTPW
  TPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIALVPVFCGLLVAKSLVLSA
  LLVWWGDIWWKTVMELRSLDTQKATCHLQQVTDLPWTSVSSPVEREILYHTVARTKISDDDDEHTL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004819
• RefSeq Size: 932
• RefSeq ORF: 828
• Synonyms: CD336; dJ149M18.1; LY95; NK-p44; NKP44
• Locus ID: 9436
• UniProt ID: O95944
• Cytogenetics: 6p21.1
• Summary: Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Natural killer cell mediated cytotoxicity