CA6 (NM_001215) Human Mass Spec Standard

CAT#: PH314135

CA6 MS Standard C13 and N15-labeled recombinant protein (NP_001206)

Product Images

Coomassie blue staining of purified CA6 protein (Cat# TP314135). The protein was produced from HEK293T cells transfected with CA6 cDNA clone (Cat# RC214135) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214135
• Predicted MW: 35.37 kDa
• Protein Sequence:
  Sequence Link

  >RC214135 representing NM_001215
  Red=Cloning site Green=Tags(s)
  
  MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTG
  YETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIV
  HYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQ
  HYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPN
  QEYTLGSEFQFYLHKIEEILDYLRRALN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001206
• RefSeq Size: 1339
• RefSeq ORF: 924
• Synonyms: CA-VI; GUSTIN
• Locus ID: 765
• UniProt ID: P23280, B4DUH8
• Cytogenetics: 1p36.23
• Summary: 'The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Nitrogen metabolism