NCALD (NM_001040626) Human Mass Spec Standard
CAT#: PH314160
NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035716)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214160 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC214160 protein sequence
Red=Cloning site Green=Tags(s) MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFR TFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPE DESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001035716 |
RefSeq Size | 3673 |
RefSeq ORF | 579 |
Synonyms | MGC33870; MGC74858 |
Locus ID | 83988 |
UniProt ID | P61601, B2RB70 |
Cytogenetics | 8q22.3 |
Summary | This gene encodes a member of the neuronal calcium sensor (NCS) family of calcium-binding proteins. The protein contains an N-terminal myristoylation signal and four EF-hand calcium binding loops. The protein is cytosolic at resting calcium levels; however, elevated intracellular calcium levels induce a conformational change that exposes the myristoyl group, resulting in protein association with membranes and partial co-localization with the perinuclear trans-golgi network. The protein is thought to be a regulator of G protein-coupled receptor signal transduction. Several alternatively spliced variants of this gene have been determined, all of which encode the same protein; additional variants may exist but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410350 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421783 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421784 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421785 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421786 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421787 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421788 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421789 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425715 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425716 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425717 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425718 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425719 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425720 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425721 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410350 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 8 |
USD 396.00 |
|
LY421783 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 1 |
USD 396.00 |
|
LY421784 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 2 |
USD 396.00 |
|
LY421785 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 3 |
USD 396.00 |
|
LY421786 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 4 |
USD 396.00 |
|
LY421787 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 5 |
USD 396.00 |
|
LY421788 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 6 |
USD 396.00 |
|
LY421789 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 7 |
USD 396.00 |
|
LY425715 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 1 |
USD 396.00 |
|
LY425716 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 2 |
USD 396.00 |
|
LY425717 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 3 |
USD 396.00 |
|
LY425718 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 4 |
USD 396.00 |
|
LY425719 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 5 |
USD 396.00 |
|
LY425720 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 6 |
USD 396.00 |
|
LY425721 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 7 |
USD 396.00 |
|
PH306321 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035720) |
USD 2,055.00 |
|
PH312908 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035718) |
USD 2,055.00 |
|
PH313925 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035715) |
USD 2,055.00 |
|
PH314659 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_114430) |
USD 2,055.00 |
|
PH318434 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035719) |
USD 2,055.00 |
|
PH320693 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035717) |
USD 2,055.00 |
|
PH321428 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035714) |
USD 2,055.00 |
|
TP306321 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 7 |
USD 823.00 |
|
TP312908 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 5 |
USD 823.00 |
|
TP313925 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 2 |
USD 748.00 |
|
TP314160 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 3 |
USD 748.00 |
|
TP314659 | Recombinant protein of human neurocalcin delta (NCALD), transcript variant 8 |
USD 748.00 |
|
TP318434 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 6 |
USD 748.00 |
|
TP320693 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 4 |
USD 748.00 |
|
TP321428 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 1 |
USD 748.00 |
|
TP720212 | Recombinant protein of human neurocalcin delta (NCALD), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review