CTDSPL (NM_005808) Human Mass Spec Standard

CAT#: PH314440

CTDSPL MS Standard C13 and N15-labeled recombinant protein (NP_005799)

Product Images

Coomassie blue staining of purified CTDSPL protein (Cat# TP314440). The protein was produced from HEK293T cells transfected with CTDSPL cDNA clone (Cat# RC214440) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214440
• Predicted MW: 29.8 kDa
• Protein Sequence:
  Sequence Link

  >RC214440 representing NM_005808
  Red=Cloning site Green=Tags(s)
  
  MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLV
  EENGGLQKPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHV
  DEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIV
  DNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005799
• RefSeq Size: 4422
• RefSeq ORF: 795
• Synonyms: C3orf8; HYA22; PSR1; RBSP3; SCP3
• Locus ID: 10217
• UniProt ID: O15194
• Cytogenetics: 3p22.2
• Protein Families: Druggable Genome, Phosphatase