Epigen (EPGN) (NM_001013442) Human Mass Spec Standard

CAT#: PH314501

EPGN MS Standard C13 and N15-labeled recombinant protein (NP_001013460)

Product Images

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214501
• Predicted MW: 14.6 kDa
• Protein Sequence:
  Sequence Link

  >RC214501 representing NM_001013442
  Red=Cloning site Green=Tags(s)
  
  MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHEL
  EKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRYEKDKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001013460
• RefSeq Size: 847
• RefSeq ORF: 399
• Synonyms: ALGV3072; EPG; epigen; PRO9904
• Locus ID: 255324
• Cytogenetics: 4q13.3
• Summary: The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
• Protein Families: Transmembrane