RGS11 (NM_003834) Human Mass Spec Standard
CAT#: PH314542
RGS11 MS Standard C13 and N15-labeled recombinant protein (NP_003825)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214542 |
Predicted MW | 50.5 kDa |
Protein Sequence |
>RC214542 representing NM_003834
Red=Cloning site Green=Tags(s) MERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEEEALHLGAVLVQHGYIYPLRDP RSLMLRPDETPYRFQTPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVDYEKDCYDRLHKKINHAWDLVL MQAREQLRAAKQRSKGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIE YFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDAYWVMNAPTVAAPTKLRVERWG FSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTLVDAVYEQFLAPGAAHWVNIDS RTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRRVFPFTWRPRHS SPSPALLPTPVEPTAACGPGGGDGVA SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003825 |
RefSeq Size | 2384 |
RefSeq ORF | 1338 |
Synonyms | RS11 |
Locus ID | 8786 |
UniProt ID | O94810 |
Cytogenetics | 16p13.3 |
Summary | The protein encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Alternative splicing occurs at this locus and four transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Nov 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405244 | RGS11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC418405 | RGS11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY405244 | Transient overexpression lysate of regulator of G-protein signaling 11 (RGS11), transcript variant 1 |
USD 605.00 |
|
LY418405 | Transient overexpression lysate of regulator of G-protein signaling 11 (RGS11), transcript variant 2 |
USD 605.00 |
|
PH315185 | RGS11 MS Standard C13 and N15-labeled recombinant protein (NP_899180) |
USD 2,055.00 |
|
TP314542 | Recombinant protein of human regulator of G-protein signaling 11 (RGS11), transcript variant 2 |
USD 788.00 |
|
TP315185 | Recombinant protein of human regulator of G-protein signaling 11 (RGS11), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review