Calcitonin (CALCA) (NM_001741) Human Mass Spec Standard
CAT#: PH314594
CALCA MS Standard C13 and N15-labeled recombinant protein (NP_001732)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214594 |
Predicted MW | 15.5 kDa |
Protein Sequence |
>RC214594 protein sequence
Red=Cloning site Green=Tags(s) MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ EREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNA N myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001732 |
RefSeq Size | 792 |
RefSeq ORF | 423 |
Synonyms | CALC1; CGRP; CGRP-I; CGRP1; CT; KC; PCT |
Locus ID | 796 |
UniProt ID | P01258 |
Cytogenetics | 11p15.2 |
Summary | 'This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2014]' |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419771 | CALCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422430 | CALCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425590 | CALCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419771 | Transient overexpression lysate of calcitonin-related polypeptide alpha (CALCA), transcript variant 1 |
USD 396.00 |
|
LY422430 | Transient overexpression lysate of calcitonin-related polypeptide alpha (CALCA), transcript variant 2 |
USD 396.00 |
|
LY425590 | Transient overexpression lysate of calcitonin-related polypeptide alpha (CALCA), transcript variant 2 |
USD 396.00 |
|
TP314594 | Recombinant protein of human calcitonin-related polypeptide alpha (CALCA), transcript variant 1 |
USD 748.00 |
|
TP720503 | Recombinant protein of human calcitonin-related polypeptide alpha (CALCA) |
USD 330.00 |
|
TP720989 | Purified recombinant protein of Human calcitonin-related polypeptide alpha (CALCA), transcript variant 2 |
USD 330.00 |
|
TP750123 | Purified recombinant protein of Human calcitonin-related polypeptide alpha (PCT), transcript variant 1, N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review