SULT1A2 (NM_177528) Human Mass Spec Standard
CAT#: PH314872
SULT1A2 MS Standard C13 and N15-labeled recombinant protein (NP_803564)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214872 |
Predicted MW | 34.3 kDa |
Protein Sequence |
>RC214872 protein sequence
Red=Cloning site Green=Tags(s) MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC HRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYY HFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF VGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY AEKMAGCSLSFRSEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_803564 |
RefSeq Size | 1348 |
RefSeq ORF | 885 |
Synonyms | HAST4; P-PST; P-PST 2; ST1A2; STP2; TSPST2 |
Locus ID | 6799 |
UniProt ID | P50226 |
Cytogenetics | 16p11.2 |
Summary | 'Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Two alternatively spliced variants that encode the same protein have been described. [provided by RefSeq, Jul 2008]' |
Protein Pathways | Sulfur metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406097 | SULT1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420734 | SULT1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430474 | SULT1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY406097 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 2 |
USD 325.00 |
|
LY420734 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 1 |
USD 325.00 |
|
LY430474 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 2 |
USD 325.00 |
|
PH324689 | SULT1A2 MS Standard C13 and N15-labeled recombinant protein (NP_001045) |
USD 2,055.00 |
|
TP314872 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 2 |
USD 748.00 |
|
TP324689 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 1 |
USD 748.00 |
|
TP720860 | Purified recombinant protein of Human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 2 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review