GOSR1 (NM_001007024) Human Mass Spec Standard
CAT#: PH314955
GOSR1 MS Standard C13 and N15-labeled recombinant protein (NP_001007025)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214955 |
Predicted MW | 28.61 kDa |
Protein Sequence |
>RC214955 representing NM_001007024
Red=Cloning site Green=Tags(s) MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETM AIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMG SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLAN RFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001007025 |
RefSeq Size | 5246 |
RefSeq ORF | 750 |
Synonyms | GOLIM2; GOS-28; GOS28; GOS28/P28; GS28; P28 |
Locus ID | 9527 |
UniProt ID | O95249 |
Cytogenetics | 17q11.2 |
Summary | This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423566 | GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423567 | GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425197 | GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY423566 | Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3 |
USD 396.00 |
|
LY423567 | Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 2 |
USD 396.00 |
|
LY425197 | Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3 |
USD 396.00 |
|
TP314955 | Recombinant protein of human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3 |
USD 748.00 |
|
TP760954 | Purified recombinant protein of Human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review