Amylin (IAPP) (NM_000415) Human Mass Spec Standard
CAT#: PH315074
IAPP MS Standard C13 and N15-labeled recombinant protein (NP_000406)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215074 |
| Predicted MW | 9.81 kDa |
| Protein Sequence |
>RC215074 representing NM_000415
Red=Cloning site Green=Tags(s) MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY GKRNAVEVLKREPLNYLPL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000406 |
| RefSeq Size | 1462 |
| RefSeq ORF | 267 |
| Synonyms | DAP; IAP |
| Locus ID | 3375 |
| UniProt ID | P10997, A0A024RAU1 |
| Cytogenetics | 12p12.1 |
| Summary | 'This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity. [provided by RefSeq, Jul 2016]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Maturity onset diabetes of the young |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400146 | IAPP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400146 | Transient overexpression lysate of islet amyloid polypeptide (IAPP) |
USD 436.00 |
|
| TP315074 | Recombinant protein of human islet amyloid polypeptide precursor (IAPP) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China