EDA (NM_001005610) Human Mass Spec Standard

CAT#: PH315628

EDA MS Standard C13 and N15-labeled recombinant protein (NP_001005610)

Product Images

Coomassie blue staining of purified EDA protein (Cat# TP315628). The protein was produced from HEK293T cells transfected with EDA cDNA clone (Cat# RC215628) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215628
• Predicted MW: 19 kDa
• Protein Sequence:
  Sequence Link

  >RC215628 representing NM_001005610
  Red=Cloning site Green=Tags(s)
  
  MGYPEVERRELLPAAAPRERGSQGCGCGGAPARAGEGNSCLLFLGFFGLSLALHLLTLCCYLELRSELRR
  ERGAESRLGGSGTPGTSGTLSSLGGLDPDSPITSHLGQPSPKQQPLEPGEAALHSDSQDGHQMALLNFFF
  PDEKPYSEEESRRVRRNKRSKSNEGADGKSTQLILYHF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001005610
• RefSeq Size: 1089
• RefSeq ORF: 534
• Synonyms: ECTD1; ED1; ED1-A1; ED1-A2; EDA-A1; EDA-A2; EDA1; EDA2; HED; HED1; ODT1; STHAGX1; TNLG7C; XHED; XLHED
• Locus ID: 1896
• UniProt ID: Q92838
• Cytogenetics: Xq13.1
• Summary: 'The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction