MSI1 (NM_002442) Human Mass Spec Standard

CAT#: PH315992

MSI1 MS Standard C13 and N15-labeled recombinant protein (NP_002433)

Product Images

Coomassie blue staining of purified MSI1 protein (Cat# TP315992). The protein was produced from HEK293T cells transfected with MSI1 cDNA clone (Cat# RC215992) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215992
• Predicted MW: 38.9 kDa
• Protein Sequence:
  Sequence Link

  >RC215992 representing NM_002442
  Red=Cloning site Green=Tags(s)
  
  METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD
  QAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAML
  MFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAF
  MLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAA
  AVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGG
  PLIATAFTNGYH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002433
• RefSeq Size: 2950
• RefSeq ORF: 1086
• Synonyms: musashi 1; musashi homolog 1 (Drosophila)
• Locus ID: 4440
• UniProt ID: O43347
• Cytogenetics: 12q24.31
• Summary: 'This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13. [provided by RefSeq, Jul 2008]'