SLC25A33 (NM_032315) Human Mass Spec Standard

CAT#: PH316002

SLC25A33 MS Standard C13 and N15-labeled recombinant protein (NP_115691)

Product Images

Coomassie blue staining of purified SLC25A33 protein (Cat# TP316002). The protein was produced from HEK293T cells transfected with SLC25A33 cDNA clone (Cat# RC216002) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216002
• Predicted MW: 35.4 kDa
• Protein Sequence:
  Sequence Link

  >RC216002 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSV
  TPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAF
  ITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESL
  KKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFR
  EEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115691
• RefSeq Size: 1476
• RefSeq ORF: 963
• Synonyms: BMSC-MCP; PNC1
• Locus ID: 84275
• UniProt ID: Q9BSK2
• Cytogenetics: 1p36.22
• Summary: SLC25A33 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]). [supplied by OMIM, Mar 2008]
• Protein Families: Transmembrane