Histone H2A Bbd (H2AFB1) (NM_001017990) Human Mass Spec Standard

CAT#: PH316020

H2AFB1 MS Standard C13 and N15-labeled recombinant protein (NP_001017990)

Product Images

Coomassie blue staining of purified H2AFB1 protein (Cat# TP316020). The protein was produced from HEK293T cells transfected with H2AFB1 cDNA clone (Cat# RC216020) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216020
• Predicted MW: 12.7 kDa
• Protein Sequence:
  Sequence Link

  >RC216020 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL
  AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001017990
• RefSeq Size: 517
• RefSeq ORF: 345
• Synonyms: H2A.B; H2A.Bbd; H2AFB1
• Locus ID: 474382
• UniProt ID: P0C5Y9
• Cytogenetics: Xq28
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the most centromeric copy which is in intron 22 of the F8 gene. [provided by RefSeq, Oct 2015]
• Protein Pathways: Systemic lupus erythematosus