IL32 (NM_001012633) Human Mass Spec Standard
CAT#: PH316048
IL32 MS Standard C13 and N15-labeled recombinant protein (NP_001012651)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216048 |
Predicted MW | 14.7 kDa |
Protein Sequence |
>RC216048 representing NM_001012633
Red=Cloning site Green=Tags(s) MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELT PLFEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001012651 |
RefSeq Size | 919 |
RefSeq ORF | 393 |
Synonyms | IL-32alpha; IL-32beta; IL-32delta; IL-32gamma; NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd |
Locus ID | 9235 |
UniProt ID | P24001 |
Cytogenetics | 16p13.3 |
Summary | This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401352 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422819 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422884 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422885 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422886 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422889 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425323 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425328 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401352 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 2 |
USD 325.00 |
|
LY422819 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 8 |
USD 325.00 |
|
LY422884 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 1 |
USD 325.00 |
|
LY422885 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 3 |
USD 325.00 |
|
LY422886 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 4 |
USD 325.00 |
|
LY422889 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 7 |
USD 325.00 |
|
LY425323 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 7 |
USD 325.00 |
|
LY425328 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 8 |
USD 325.00 |
|
PH317258 | IL32 MS Standard C13 and N15-labeled recombinant protein (NP_001012736) |
USD 2,055.00 |
|
TP316048 | Recombinant protein of human interleukin 32 (IL32), transcript variant 4 |
USD 399.00 |
|
TP317258 | Recombinant protein of human interleukin 32 (IL32), transcript variant 8 |
USD 788.00 |
|
TP761648 | Purified recombinant protein of Human interleukin 32 (IL32), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review