PDE6 gamma (PDE6G) (NM_002602) Human Mass Spec Standard

CAT#: PH316236

PDE6G MS Standard C13 and N15-labeled recombinant protein (NP_002593)

Product Images

Coomassie blue staining of purified PDE6G protein (Cat# TP316236). The protein was produced from HEK293T cells transfected with PDE6G cDNA clone (Cat# RC216236) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216236
• Predicted MW: 9.6 kDa
• Protein Sequence:
  Sequence Link

  >RC216236 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPW
  EAFNHLELHELAQYGII
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002593
• RefSeq Size: 1064
• RefSeq ORF: 261
• Synonyms: PDEG; RP57
• Locus ID: 5148
• UniProt ID: P18545
• Cytogenetics: 17q25.3
• Summary: 'This gene encodes the gamma subunit of cyclic GMP-phosphodiesterase, which is composed of alpha- and beta- catalytic subunits and two identical, inhibitory gamma subunits. This gene is expressed in rod photoreceptors and functions in the phototransduction signaling cascade. It is also expressed in a variety of other tissues, and has been shown to regulate the c-Src protein kinase and G-protein-coupled receptor kinase 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009]'
• Protein Families: Druggable Genome
• Protein Pathways: Progesterone-mediated oocyte maturation, Purine metabolism