DUSP15 (NM_177991) Human Mass Spec Standard

CAT#: PH316271

DUSP15 MS Standard C13 and N15-labeled recombinant protein (NP_817130)

Product Images

Coomassie blue staining of purified DUSP15 protein (Cat# TP316271). The protein was produced from HEK293T cells transfected with DUSP15 cDNA clone (Cat# RC216271) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216271
• Predicted MW: 14.5 kDa
• Protein Sequence:
  Sequence Link

  >RC216271 representing NM_177991
  Red=Cloning site Green=Tags(s)
  
  MTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKLRRQLEERFGESPFRDEEELRALLPLCK
  RCRQGSATSASSAGPHSAASEGTVQRLVPRTPREAHRPLPLLARVKQTFSCLPRCLSRKGGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_817130
• RefSeq Size: 1184
• RefSeq ORF: 396
• Synonyms: C20orf57; VHY
• Locus ID: 128853
• UniProt ID: Q9H1R2
• Cytogenetics: 20q11.21
• Summary: The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocytes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
• Protein Families: Druggable Genome, Phosphatase