NMDAR1 (GRIN1) (NM_007327) Human Mass Spec Standard
CAT#: PH316458
GRIN1 MS Standard C13 and N15-labeled recombinant protein (NP_015566)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216458 |
Predicted MW | 105.37 kDa |
Protein Sequence |
>RC216458 representing NM_007327
Red=Cloning site Green=Tags(s) MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPN AIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRT VPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERESKAEKVLQFDPGTKNVTALLME AKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAH ISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFAN YSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERV NNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQS TLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSAR ILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELS TMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQ NVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH KDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQ NQKDTVLPRRAIEREEGQLQLCSRHRES myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_015566 |
RefSeq Size | 5137 |
RefSeq ORF | 2814 |
Synonyms | GluN1; MRD8; NDHMSD; NDHMSR; NMD-R1; NMDA1; NMDAR1; NR1 |
Locus ID | 2902 |
UniProt ID | Q05586 |
Cytogenetics | 9q34.3 |
Summary | 'The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Ion Channels: Glutamate Receptors, Transmembrane |
Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Calcium signaling pathway, Huntington's disease, Long-term potentiation, Neuroactive ligand-receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402129 | GRIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC424497 | GRIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425015 | GRIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY402129 | Transient overexpression lysate of glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-3 |
USD 605.00 |
|
LY424497 | Transient overexpression lysate of glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-1 |
USD 605.00 |
|
LY425015 | Transient overexpression lysate of glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-1 |
USD 605.00 |
|
PH319368 | GRIN1 MS Standard C13 and N15-labeled recombinant protein (NP_000823) |
USD 2,055.00 |
|
TP316458 | Recombinant protein of human glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-3 |
USD 867.00 |
|
TP319368 | Recombinant protein of human glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-1 |
USD 748.00 |
|
TP790146 | Purified recombinant protein of Human glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-3, with C-terminal DDK tag, secretory expressed in CHO cells, 50ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review