BPNT1 (NM_006085) Human Mass Spec Standard

CAT#: PH316622

BPNT1 MS Standard C13 and N15-labeled recombinant protein (NP_006076)

Product Images

Coomassie blue staining of purified BPNT1 protein (Cat# TP316622). The protein was produced from HEK293T cells transfected with BPNT1 cDNA clone (Cat# RC216622) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216622
• Predicted MW: 33.2 kDa
• Protein Sequence:
  Sequence Link

  >RC216622 representing NM_006085
  Red=Cloning site Green=Tags(s)
  
  MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLT
  IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIA
  YEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAM
  NPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMN
  SAGVLATLRNYDYYASRVPESIKNALVP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006076
• RefSeq Size: 2461
• RefSeq ORF: 924
• Synonyms: HEL20; PIP
• Locus ID: 10380
• UniProt ID: O95861, V9HWF9
• Cytogenetics: 1q41
• Summary: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq, Jul 2008]
• Protein Pathways: Sulfur metabolism