APRT (NM_000485) Human Mass Spec Standard
CAT#: PH316874
APRT MS Standard C13 and N15-labeled recombinant protein (NP_000476)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216874 |
Predicted MW | 19.6 kDa |
Protein Sequence |
>RC216874 protein sequence
Red=Cloning site Green=Tags(s) MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFL FGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAAC ELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000476 |
RefSeq Size | 807 |
RefSeq ORF | 540 |
Synonyms | AMP; APRTD |
Locus ID | 353 |
UniProt ID | P07741 |
Cytogenetics | 16q24.3 |
Summary | 'Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422236 | APRT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424695 | APRT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425509 | APRT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY422236 | Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 2 |
USD 396.00 |
|
LY424695 | Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 1 |
USD 396.00 |
|
LY425509 | Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 2 |
USD 396.00 |
|
TP316874 | Recombinant protein of human adenine phosphoribosyltransferase (APRT), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review