C1orf149 (MEAF6) (NM_022756) Human Mass Spec Standard

CAT#: PH317049

MEAF6 MS Standard C13 and N15-labeled recombinant protein (NP_073593)

Product Images

Coomassie blue staining of purified MEAF6 protein (Cat# TP317049). The protein was produced from HEK293T cells transfected with MEAF6 cDNA clone (Cat# RC217049) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217049
• Predicted MW: 22.6 kDa
• Protein Sequence:
  Sequence Link

  >RC217049 representing NM_022756
  Red=Cloning site Green=Tags(s)
  
  MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKN
  SNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDP
  EDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHSPSGMFDYDFEIDLKLNKKPRADY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_073593
• RefSeq Size: 2167
• RefSeq ORF: 603
• Synonyms: C1orf149; CENP-28; EAF6; NY-SAR-91
• Locus ID: 64769
• UniProt ID: Q9HAF1
• Cytogenetics: 1p34.3
• Summary: This gene encodes a nuclear protein involved in transcriptional activation. The encoded protein may form a component of several different histone acetyltransferase complexes. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]