RASSF2 (NM_170774) Human Mass Spec Standard
CAT#: PH317404
RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_739580)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217404 |
Predicted MW | 37.8 kDa |
Protein Sequence |
>RC217404 protein sequence
Red=Cloning site Green=Tags(s) MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_739580 |
RefSeq Size | 5307 |
RefSeq ORF | 978 |
Synonyms | CENP-34; RASFADIN |
Locus ID | 9770 |
UniProt ID | P50749 |
Cytogenetics | 20p13 |
Summary | This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406875 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC415073 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429435 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406875 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2 |
USD 396.00 |
|
LY415073 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1 |
USD 396.00 |
|
LY429435 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1 |
USD 396.00 |
|
PH316299 | RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_055552) |
USD 2,055.00 |
|
TP316299 | Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1 |
USD 748.00 |
|
TP317404 | Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review