CCDC69 (NM_015621) Human Mass Spec Standard

CAT#: PH317758

CCDC69 MS Standard C13 and N15-labeled recombinant protein (NP_056436)

Product Images

Coomassie blue staining of purified CCDC69 protein (Cat# TP317758). The protein was produced from HEK293T cells transfected with CCDC69 cDNA clone (Cat# RC217758) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217758
• Predicted MW: 34.6 kDa
• Protein Sequence:
  Sequence Link

  >RC217758 representing NM_015621
  Red=Cloning site Green=Tags(s)
  
  MGCRHSRLSSCKPPKKKRQEPEPEQPPRPEPHELGPLNGDTAITVQLCASEEAERHQKDITRILQQHEEE
  KKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRASYEQEKEALTHSFREASSTQQETIDRLTSQ
  LEAFQAKMKRVEESILSRNYKKHIQDYGSPSQFWEQELESLHFVIEMKNERIHELDRRLILMETVKEKNL
  ILEEKITTLQQENEDLHVRSRNQVVLSRQLSEDLLLTREALEKEVQLRRQLQQEKEELLYRVLGANASPA
  FPLAPVTPTEVSFLAT
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056436
• RefSeq Size: 3416
• RefSeq ORF: 888
• Synonyms: DKFZp434C171; FLJ13705
• Locus ID: 26112
• UniProt ID: A6NI79, Q7L2X4
• Cytogenetics: 5q33.1