MST3 (STK24) (NM_003576) Human Mass Spec Standard
CAT#: PH317776
STK24 MS Standard C13 and N15-labeled recombinant protein (NP_003567)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217776 |
Predicted MW | 49.1 kDa |
Protein Sequence |
>RC217776 representing NM_003576
Red=Cloning site Green=Tags(s) MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLE EAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREI LKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQLAYDS KADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKEL LKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLE NGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISD TMVAQLVQRLQRYSLSGGGTSSH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003567 |
RefSeq Size | 4539 |
RefSeq ORF | 1329 |
Synonyms | HEL-S-95; MST3; MST3B; STE20; STK3 |
Locus ID | 8428 |
UniProt ID | Q9Y6E0 |
Cytogenetics | 13q32.2 |
Summary | This gene encodes a serine/threonine protein kinase that functions upstream of mitogen-activated protein kinase (MAPK) signaling. The encoded protein is cleaved into two chains by caspases; the N-terminal fragment (MST3/N) translocates to the nucleus and promotes programmed cells death. There is a pseudogene for this gene on chromosome X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418583 | STK24 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422305 | STK24 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418583 | Transient overexpression lysate of serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 1 |
USD 605.00 |
|
LY422305 | Transient overexpression lysate of serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 2 |
USD 396.00 |
|
TP317776 | Recombinant protein of human serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 1 |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review