Protor 1 (PRR5) (NM_015366) Human Mass Spec Standard

CAT#: PH317823

PRR5 MS Standard C13 and N15-labeled recombinant protein (NP_056181)

Product Images

Coomassie blue staining of purified PRR5 protein (Cat# TP317823). The protein was produced from HEK293T cells transfected with PRR5 cDNA clone (Cat# RC217823) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217823
• Predicted MW: 41.4 kDa
• Protein Sequence:
  Sequence Link

  >RC217823 representing NM_015366
  Red=Cloning site Green=Tags(s)
  
  MSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTEL
  GSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWDFFFSDVLPMLQAIFYPVQGKEPSVRQLAL
  LHFRNAITLSVKLEDALARAHARVPPAIVQMLLVLQGVHESRGVTEDYLRLETLVQKVVSPYLGTYGLHS
  SEGPFTHSCILEKRLLRRSRSGDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSC
  PEPQGFSDPPGQGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTRSSLPRSSPENLVDQILESVDSD
  SEGIFIDFGRGRGSGMSDLEGSGGRQSVV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056181
• RefSeq Size: 1653
• RefSeq ORF: 1137
• Synonyms: FLJ20185k; PP610; PROTOR-1; PROTOR1
• Locus ID: 55615
• UniProt ID: P85299, A0A024R4U5
• Cytogenetics: 22q13.31
• Summary: This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. The protein is a component of the mammalian target of rapamycin complex 2 (mTORC2), and it regulates platelet-derived growth factor (PDGF) receptor beta expression and PDGF signaling to Akt and S6K1. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms. Read-through transcripts from this gene into the downstream Rho GTPase activating protein 8 (ARHGAP8) gene also exist, which led to the original description of PRR5 and ARHGAP8 being a single gene. [provided by RefSeq, Nov 2010]