hnRNP F (HNRNPF) (NM_001098206) Human Mass Spec Standard
CAT#: PH317995
HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091676)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217995 |
Predicted MW | 45.7 kDa |
Protein Sequence |
>RC217995 protein sequence
Red=Cloning site Green=Tags(s) MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMA LKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNG ITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPY DRPGTARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSE FTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRA NMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001091676 |
RefSeq Size | 2667 |
RefSeq ORF | 1245 |
Synonyms | HNRPF; mcs94-1; OK/SW-cl.23 |
Locus ID | 3185 |
UniProt ID | P52597, A0A024R7T3 |
Cytogenetics | 10q11.21 |
Summary | 'This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs which have guanosine-rich sequences. This protein is very similar to the family member hnRPH. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401544 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420552 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420553 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420554 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420555 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420556 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426000 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426001 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426002 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426003 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426004 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401544 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 3 |
USD 325.00 |
|
LY420552 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 2 |
USD 325.00 |
|
LY420553 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 4 |
USD 325.00 |
|
LY420554 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 5 |
USD 325.00 |
|
LY420555 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 6 |
USD 325.00 |
|
LY420556 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 1 |
USD 325.00 |
|
LY426000 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 2 |
USD 325.00 |
|
LY426001 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 4 |
USD 325.00 |
|
LY426002 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 5 |
USD 325.00 |
|
LY426003 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 6 |
USD 325.00 |
|
LY426004 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 1 |
USD 325.00 |
|
PH305100 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_004957) |
USD 2,055.00 |
|
PH312612 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091675) |
USD 2,055.00 |
|
PH312850 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091674) |
USD 2,055.00 |
|
PH313874 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091677) |
USD 2,055.00 |
|
TP305100 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 3 |
USD 823.00 |
|
TP312612 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 4 |
USD 748.00 |
|
TP312850 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 2 |
USD 823.00 |
|
TP313874 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 6 |
USD 748.00 |
|
TP317995 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 5 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review