AUH (NM_001698) Human Mass Spec Standard
CAT#: PH318117
AUH MS Standard C13 and N15-labeled recombinant protein (NP_001689)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218117 |
Predicted MW | 35.61 kDa |
Protein Sequence |
>RC218117 representing NM_001698
Red=Cloning site Green=Tags(s) MAAAVAAAPGALGSLHAGGARLVAACSAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSE MKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAG ADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVET KLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLP QGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001689 |
RefSeq Size | 1548 |
RefSeq ORF | 1017 |
Synonyms | 3-methylglutaconyl-CoA hydratase; AU-binding protein; AU-specific RNA-binding enoyl-CoA hydratase; AU RNA-binding protein; AU RNA binding protein; Enoyl-CoA hydratase; enoyl-Coenzyme A hydratase; OTTHUMP00000021631 |
Locus ID | 549 |
UniProt ID | Q13825 |
Cytogenetics | 9q22.31 |
Summary | 'This gene encodes bifunctional mitochondrial protein that has both RNA-binding and hydratase activities. The encoded protein is a methylglutaconyl-CoA hydratase that catalyzes the hydration of 3-methylglutaconyl-CoA to 3-hydroxy-3-methyl-glutaryl-CoA, a critical step in the leucine degradation pathway. This protein also binds AU-rich elements (AREs) found in the 3' UTRs of rapidly decaying mRNAs including c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. This protein is localizes to the mitochondrial matrix and the inner mitochondrial membrane and may be involved in mitochondrial protein synthesis. Mutations in this gene are the cause of 3-methylglutaconic aciduria, type I. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]' |
Protein Pathways | Metabolic pathways, Valine, leucine and isoleucine degradation |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419798 | AUH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419798 | Transient overexpression lysate of AU RNA binding protein/enoyl-Coenzyme A hydratase (AUH), nuclear gene encoding mitochondrial protein |
USD 325.00 |
|
TP318117 | Recombinant protein of human AU RNA binding protein/enoyl-Coenzyme A hydratase (AUH), nuclear gene encoding mitochondrial protein |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review