HAO2 (NM_001005783) Human Mass Spec Standard

CAT#: PH318416

HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005783)

Product Images

Coomassie blue staining of purified HAO2 protein (Cat# TP318416). The protein was produced from HEK293T cells transfected with HAO2 cDNA clone (Cat# RC218416) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218416
• Predicted MW: 38.8 kDa
• Protein Sequence:
  Sequence Link

  >RC218416 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS
  APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ
  LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW
  FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV
  RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR
  L
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001005783
• RefSeq Size: 1708
• RefSeq ORF: 1053
• Synonyms: GIG16; HAOX2
• Locus ID: 51179
• UniProt ID: Q9NYQ3
• Cytogenetics: 1p12
• Summary: This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Pathways: Glyoxylate and dicarboxylate metabolism, Metabolic pathways