SMAGP (NM_001031628) Human Mass Spec Standard
CAT#: PH318509
SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001026798)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218509 |
Predicted MW | 10.7 kDa |
Protein Sequence |
>RC218509 protein sequence
Red=Cloning site Green=Tags(s) MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYE PTEGEPSAIVQMESDLAKGSEKEEYFI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001026798 |
RefSeq Size | 1087 |
RefSeq ORF | 291 |
Synonyms | hSMAGP |
Locus ID | 57228 |
UniProt ID | Q0VAQ4 |
Cytogenetics | 12q13.13 |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412438 | LOC57228 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422217 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422425 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425586 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429624 | LOC57228 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412438 | Transient overexpression lysate of small trans-membrane and glycosylated protein (LOC57228), transcript variant 2 |
USD 396.00 |
|
LY422217 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 1 |
USD 396.00 |
|
LY422425 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 2 |
USD 396.00 |
|
LY425586 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 2 |
USD 396.00 |
|
LY429624 | Transient overexpression lysate of small trans-membrane and glycosylated protein (LOC57228), transcript variant 2 |
USD 396.00 |
|
PH303589 | SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001029045) |
USD 2,055.00 |
|
TP303589 | Recombinant protein of human small trans-membrane and glycosylated protein (LOC57228), transcript variant 2 |
USD 823.00 |
|
TP318509 | Recombinant protein of human small trans-membrane and glycosylated protein (LOC57228), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review