AMPK alpha 1 (PRKAA1) (NM_006251) Human Mass Spec Standard
CAT#: PH318572
PRKAA1 MS Standard C13 and N15-labeled recombinant protein (NP_006242)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218572 |
Predicted MW | 63.8 kDa |
Protein Sequence |
>RC218572 representing NM_006251
Red=Cloning site Green=Tags(s) MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVG KIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDY CHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWS SGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFK QDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKD FYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTAT PQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006242 |
RefSeq Size | 5085 |
RefSeq ORF | 1677 |
Synonyms | AMPK; AMPKa1 |
Locus ID | 5562 |
UniProt ID | Q13131 |
Cytogenetics | 5p13.1 |
Summary | 'The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Adipocytokine signaling pathway, Hypertrophic cardiomyopathy (HCM), Insulin signaling pathway, mTOR signaling pathway, Regulation of autophagy |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404162 | PRKAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC416771 | PRKAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC430955 | PRKAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY404162 | Transient overexpression lysate of protein kinase, AMP-activated, alpha 1 catalytic subunit (PRKAA1), transcript variant 2 |
USD 495.00 |
|
LY416771 | Transient overexpression lysate of protein kinase, AMP-activated, alpha 1 catalytic subunit (PRKAA1), transcript variant 1 |
USD 495.00 |
|
LY430955 | Transient overexpression lysate of protein kinase, AMP-activated, alpha 1 catalytic subunit (PRKAA1), transcript variant 2 |
USD 325.00 |
|
TP318572 | Recombinant protein of human protein kinase, AMP-activated, alpha 1 catalytic subunit (PRKAA1), transcript variant 1 |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review