INMT (NM_006774) Human Mass Spec Standard

CAT#: PH318678

INMT MS Standard C13 and N15-labeled recombinant protein (NP_006765)

Product Images

Coomassie blue staining of purified INMT protein (Cat# TP318678). The protein was produced from HEK293T cells transfected with INMT cDNA clone (Cat# RC218678) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218678
• Predicted MW: 28.7 kDa
• Protein Sequence:
  Sequence Link

  >RC218678 representing NM_006774
  Red=Cloning site Green=Tags(s)
  
  MKGGFTGGDEYQKHFLPRDYLATYYSFNGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQ
  VLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLK
  CDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYVVGKRE
  FSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006765
• RefSeq Size: 2639
• RefSeq ORF: 789
• Synonyms: TEMT
• Locus ID: 11185
• UniProt ID: O95050
• Cytogenetics: 7p14.3
• Summary: N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream FAM188B (family with sequence similarity 188, member B) gene. [provided by RefSeq, Nov 2010]
• Protein Pathways: Tryptophan metabolism