Ataxin 3 (ATXN3) (NM_004993) Human Mass Spec Standard

CAT#: PH318923

ATXN3 MS Standard C13 and N15-labeled recombinant protein (NP_004984)

Product Images

Coomassie blue staining of purified ATXN3 protein (Cat# TP318923). The protein was produced from HEK293T cells transfected with ATXN3 cDNA clone (Cat# RC218923) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218923
• Predicted MW: 41.1 kDa
• Protein Sequence:
  Sequence Link

  >RC218923 representing NM_004993
  Red=Cloning site Green=Tags(s)
  
  MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMD
  DSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGP
  ELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLE
  RVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEE
  LRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLET
  VRNDLKTEGKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004984
• RefSeq Size: 2698
• RefSeq ORF: 1083
• Synonyms: AT3; ATX3; JOS; MJD; MJD1; SCA3
• Locus ID: 4287
• UniProt ID: P54252
• Cytogenetics: 14q32.12
• Summary: 'Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 12-44 to 52-86 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2016]'
• Protein Families: Druggable Genome, Transcription Factors