Clathrin light chain (CLTA) (NM_007096) Human Mass Spec Standard

CAT#: PH319035

CLTA MS Standard C13 and N15-labeled recombinant protein (NP_009027)

Product Images

Coomassie blue staining of purified CLTA protein (Cat# TP319035). The protein was produced from HEK293T cells transfected with CLTA cDNA clone (Cat# RC219035) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219035
• Predicted MW: 26.9 kDa
• Protein Sequence:
  Sequence Link

  >RC219035 representing NM_007096
  Red=Cloning site Green=Tags(s)
  
  MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPG
  GPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAI
  KELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTE
  WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009027
• RefSeq Size: 1105
• RefSeq ORF: 744
• Synonyms: LCA
• Locus ID: 1211
• UniProt ID: P09496
• Cytogenetics: 9p13.3
• Summary: 'Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, May 2010]'
• Protein Pathways: Endocytosis, Huntington's disease, Lysosome