VPS13B (NM_181661) Human Mass Spec Standard
CAT#: PH319188
VPS13B MS Standard C13 and N15-labeled recombinant protein (NP_858047)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219188 |
Predicted MW | 47 kDa |
Protein Sequence |
>RC219188 representing NM_181661
Red=Cloning site Green=Tags(s) MLESYVTPILMSYVNRYIKNLKPSDLQLSLWGGDVVLSKLELKLDVLEQELKLPFTFLSGHIHELRIHVP WTKLGSEPVVITINTMECILKLKDGIQDDHESCGSNSTNRSTAESTKSSIKPRRMQQAAPTDPDLPPGYV QSLIRRVVNNVNIVINNLILKYVEDDIVLSVNITSAECYTVGELWDRAFMDISATDLVLRKVINFSDCTV CLDKRNASGKIEFYQDPLLYKCSFRTRLHFTYENLNSKMPSVIKIHTLVESLKLSITDQQLPMFIRIMQL GIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETRIDMQYPAQHKGQELYSQQDEEQPQGWVSWAW SFVPAIVSYDDGEEDFVGNDPASTMHQQKAQTLKDPIVSIGFYCTKATVTFKVGLFSCCLYLYQL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_858047 |
RefSeq Size | 1634 |
RefSeq ORF | 1245 |
Synonyms | CHS1; COH1 |
Locus ID | 157680 |
UniProt ID | Q7Z7G8 |
Cytogenetics | 8q22.2 |
Summary | This gene encodes a potential transmembrane protein that may function in vesicle-mediated transport and sorting of proteins within the cell. This protein may play a role in the development and the function of the eye, hematological system, and central nervous system. Mutations in this gene have been associated with Cohen syndrome. Multiple splice variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405555 | VPS13B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405555 | Transient overexpression lysate of vacuolar protein sorting 13 homolog B (yeast) (VPS13B), transcript variant 4 |
USD 396.00 |
|
TP319188 | Recombinant protein of human vacuolar protein sorting 13 homolog B (yeast) (VPS13B), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review