AMN (NM_030943) Human Mass Spec Standard

CAT#: PH319248

AMN MS Standard C13 and N15-labeled recombinant protein (NP_112205)

Product Images

Coomassie blue staining of purified AMN protein (Cat# TP319248). The protein was produced from HEK293T cells transfected with AMN cDNA clone (Cat# RC219248) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219248
• Predicted MW: 45.6 kDa
• Protein Sequence:
  Sequence Link

  >RC219248 representing NM_030943
  Red=Cloning site Green=Tags(s)
  
  MGVLGRVLLWLQLCALTQAVSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDML
  LPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHD
  DVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPGALSVGPEDCADPSG
  CVCGNAEAQPWICAALLQPLGGRCPQAACHFALRPQGQCCDLCGAVVLLTHGPAFDLERYRARILDTFLG
  LPQYHGLQVAVSKVPRSSRLREADTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATMRESG
  AHVWGSSAAGLAGGVAAAVLLALLVLLVAPPLLRRAGRLRWRRHEAAAPAGAPLGFRNPVFDVTASEELP
  LPRRLSLVPKAAADSTSHSYFVNPLFAGAEAEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112205
• RefSeq Size: 1896
• RefSeq ORF: 1359
• Synonyms: amnionless; PRO1028
• Locus ID: 81693
• UniProt ID: Q9BXJ7
• Cytogenetics: 14q32.32
• Summary: The protein encoded by this gene is a type I transmembrane protein. It is thought to modulate bone morphogenetic protein (BMP) receptor function by serving as an accessory or coreceptor, and thus facilitates or hinders BMP binding. It is known that the mouse AMN gene is expressed in the extraembryonic visceral endoderm layer during gastrulation, but it is found to be mutated in amnionless mouse. The encoded protein has sequence similarity to short gastrulation (Sog) and procollagen IIA proteins in Drosophila. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane