DUSP18 (NM_152511) Human Mass Spec Standard

CAT#: PH319496

DUSP18 MS Standard C13 and N15-labeled recombinant protein (NP_689724)

Product Images

Coomassie blue staining of purified DUSP18 protein (Cat# TP319496). The protein was produced from HEK293T cells transfected with DUSP18 cDNA clone (Cat# RC219496) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219496
• Predicted MW: 20.9 kDa
• Protein Sequence:
  Sequence Link

  >RC219496 representing NM_152511
  Red=Cloning site Green=Tags(s)
  
  MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVP
  VADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPI
  IRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689724
• RefSeq Size: 2453
• RefSeq ORF: 564
• Synonyms: DSP18; DUSP20; LMWDSP20
• Locus ID: 150290
• UniProt ID: Q8NEJ0, A0A024R1L2
• Cytogenetics: 22q12.2
• Summary: Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP18 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]). [supplied by OMIM, Dec 2009]
• Protein Families: Druggable Genome, Phosphatase