KCTD1 (NM_198991) Human Mass Spec Standard
CAT#: PH319713
KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_945342)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219713 |
Predicted MW | 29.4 kDa |
Protein Sequence |
>RC219713 protein sequence
Red=Cloning site Green=Tags(s) MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDS LKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPC ECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERL QQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_945342 |
RefSeq Size | 1754 |
RefSeq ORF | 771 |
Synonyms | C18orf5 |
Locus ID | 284252 |
UniProt ID | Q719H9, A0A024RC45 |
Cytogenetics | 18q11.2 |
Summary | This gene encodes a protein containing a BTB (Broad-complex, tramtrack and bric a brac), also known as a POZ (POxvirus and zinc finger) protein-protein interaction domain. The encoded protein negatively regulates the AP-2 family of transcription factors and the Wnt signaling pathway. A mechanism for the modulation of Wnt signaling has been proposed in which the encoded protein enhances ubiquitination and degradation of the beta-catenin protein. Mutations in this gene have been identified in Scalp-ear-nipple (SEN) syndrome. [provided by RefSeq, May 2017] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404704 | KCTD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427853 | KCTD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404704 | Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2 |
USD 396.00 |
|
LY427853 | Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1 |
USD 396.00 |
|
PH326740 | KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_001129677) |
USD 2,055.00 |
|
TP319713 | Recombinant protein of human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2 |
USD 748.00 |
|
TP326740 | Recombinant protein of human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review