FHL2 (NM_001039492) Human Mass Spec Standard

CAT#: PH319762

FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_001034581)

Product Images

Coomassie blue staining of purified FHL2 protein (Cat# TP319762). The protein was produced from HEK293T cells transfected with FHL2 cDNA clone (Cat# RC219762) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219762
• Predicted MW: 32.2 kDa
• Protein Sequence:
  Sequence Link

  >RC219762 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ
  CRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKS
  FIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCL
  NCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001034581
• RefSeq Size: 1552
• RefSeq ORF: 837
• Synonyms: AAG11; DRAL; FHL-2; SLIM-3; SLIM3
• Locus ID: 2274
• UniProt ID: Q14192, Q6I9R8, Q2XQU9
• Cytogenetics: 2q12.2
• Summary: 'This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jan 2016]'
• Protein Families: Druggable Genome