UQCRHL (NM_001089591) Human Mass Spec Standard

CAT#: PH319881

UQCRHL MS Standard C13 and N15-labeled recombinant protein (NP_001083060)

Product Images

Coomassie blue staining of purified UQCRHL protein (Cat# TP319881). The protein was produced from HEK293T cells transfected with UQCRHL cDNA clone (Cat# RC219881) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219881
• Predicted MW: 10.6 kDa
• Protein Sequence:
  Sequence Link

  >RC219881 representing NM_001089591
  Red=Cloning site Green=Tags(s)
  
  MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEE
  LFDFLHAKDHCVAHKLFNNLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001083060
• RefSeq Size: 538
• RefSeq ORF: 273
• Locus ID: 440567
• UniProt ID: A0A096LP55
• Cytogenetics: 1p36.21
• Summary: This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-coding for now. [provided by RefSeq, Jul 2008]
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease