Ephrin A4 (EFNA4) (NM_182690) Human Mass Spec Standard
CAT#: PH320109
EFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_872632)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220109 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC220109 representing NM_182690
Red=Cloning site Green=Tags(s) MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGP ETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPES SGQCLRLQVSVCCKERNLPSHPKEPESSQDPLEEEGSLLPALGVPIQTDKMEH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_872632 |
RefSeq Size | 1111 |
RefSeq ORF | 579 |
Synonyms | EFL4; EPLG4; LERK4 |
Locus ID | 1945 |
UniProt ID | P52798 |
Cytogenetics | 1q21.3 |
Summary | 'This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified. [provided by RefSeq, Jul 2008]' |
Protein Families | Secreted Protein |
Protein Pathways | Axon guidance |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405453 | EFNA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417433 | EFNA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405453 | Transient overexpression lysate of ephrin-A4 (EFNA4), transcript variant 3 |
USD 396.00 |
|
LY417433 | Transient overexpression lysate of ephrin-A4 (EFNA4), transcript variant 1 |
USD 396.00 |
|
TP320109 | Recombinant protein of human ephrin-A4 (EFNA4), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review