COQ7 (NM_016138) Human Mass Spec Standard
CAT#: PH320317
COQ7 MS Standard C13 and N15-labeled recombinant protein (NP_057222)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220317 |
Predicted MW | 24.1 kDa |
Protein Sequence |
>RC220317 representing NM_016138
Red=Cloning site Green=Tags(s) MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQ MAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVMFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVA VEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVA IYLSERL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057222 |
RefSeq Size | 2591 |
RefSeq ORF | 651 |
Synonyms | CAT5; CLK-1; CLK1; COQ10D8 |
Locus ID | 10229 |
UniProt ID | Q99807 |
Cytogenetics | 16p12.3 |
Summary | The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010] |
Protein Pathways | Metabolic pathways, Ubiquinone and other terpenoid-quinone biosynthesis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414165 | COQ7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC433767 | COQ7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414165 | Transient overexpression lysate of coenzyme Q7 homolog, ubiquinone (yeast) (COQ7) |
USD 396.00 |
|
LY433767 | Transient overexpression lysate of coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), transcript variant 2 |
USD 396.00 |
|
TP320317 | Recombinant protein of human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7) |
USD 399.00 |
{0} Product Review(s)
Be the first one to submit a review