ST13 (NM_003932) Human Mass Spec Standard

CAT#: PH320533

ST13 MS Standard C13 and N15-labeled recombinant protein (NP_003923)

Product Images

Coomassie blue staining of purified ST13 protein (Cat# TP320533). The protein was produced from HEK293T cells transfected with ST13 cDNA clone (Cat# RC220533) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220533
• Predicted MW: 41.2 kDa
• Protein Sequence:
  Sequence Link

  >RC220533 representing NM_003932
  Red=Cloning site Green=Tags(s)
  
  MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLK
  ADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDA
  IKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACK
  LDYDEDASAMLKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGS
  FPGGFPGGMPGNFPGGMPGMGGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQS
  NPKVMNLISKLSAKFGGQA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003923
• RefSeq Size: 3214
• RefSeq ORF: 1107
• Synonyms: AAG2; FAM10A1; FAM10A4; HIP; HOP; HSPABP; HSPABP1; P48; PRO0786; SNC6
• Locus ID: 6767
• UniProt ID: P50502, Q0IJ56, A0A140VKA6
• Cytogenetics: 22q13.2
• Summary: 'The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that it is a candidate tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013]'
• Protein Families: Druggable Genome