PKC beta 1 (PRKCB) (NM_212535) Human Mass Spec Standard
CAT#: PH320599
PRKCB MS Standard C13 and N15-labeled recombinant protein (NP_997700)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220599 |
Predicted MW | 76.7 kDa |
Protein Sequence |
>RC220599 representing NM_212535
Red=Cloning site Green=Tags(s) MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVC CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVH KRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQ KTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQ EEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGK GSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKE NIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAY PKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNF DKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_997700 |
RefSeq Size | 2319 |
RefSeq ORF | 2013 |
Synonyms | PKC-beta; PKCB; PKCbeta; PKCI(2); PRKCB1; PRKCB2 |
Locus ID | 5579 |
UniProt ID | P05771 |
Cytogenetics | 16p12.2-p12.1 |
Summary | 'Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | B cell receptor signaling pathway, Calcium signaling pathway, Chemokine signaling pathway, ErbB signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, Leukocyte transendothelial migration, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Natural killer cell mediated cytotoxicity, Non-small cell lung cancer, Pathways in cancer, Phosphatidylinositol signaling system, Tight junction, Vascular smooth muscle contraction, VEGF signaling pathway, Vibrio cholerae infection, Wnt signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403957 | PRKCB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC419133 | PRKCB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431009 | PRKCB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY403957 | Transient overexpression lysate of protein kinase C, beta (PRKCB), transcript variant 1 |
USD 605.00 |
|
LY419133 | Transient overexpression lysate of protein kinase C, beta (PRKCB), transcript variant 2 |
USD 396.00 |
|
LY431009 | Transient overexpression lysate of protein kinase C, beta (PRKCB), transcript variant 1 |
USD 605.00 |
|
PH307217 | PRKCB MS Standard C13 and N15-labeled recombinant protein (NP_002729) |
USD 2,055.00 |
|
TP307217 | Recombinant protein of human protein kinase C, beta (PRKCB), transcript variant 2 |
USD 867.00 |
|
TP320599 | Recombinant protein of human protein kinase C, beta (PRKCB), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review