CPVL (NM_019029) Human Mass Spec Standard
CAT#: PH320622
CPVL MS Standard C13 and N15-labeled recombinant protein (NP_061902)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220622 |
Predicted MW | 54.2 kDa |
Protein Sequence |
>RC220622 protein sequence
Red=Cloning site Green=Tags(s) MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLN MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDF PWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYV PAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK QNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWK IFKSDSEVAGYIRQVGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061902 |
RefSeq Size | 1779 |
RefSeq ORF | 1428 |
Synonyms | HVLP |
Locus ID | 54504 |
UniProt ID | Q9H3G5, A0A024RA40 |
Cytogenetics | 7p14.3 |
Summary | The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptides. The exact function of this protein, however, has not been determined. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410561 | CPVL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC412799 | CPVL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410561 | Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 |
USD 396.00 |
|
LY412799 | Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2 |
USD 396.00 |
|
PH302336 | CPVL MS Standard C13 and N15-labeled recombinant protein (NP_112601) |
USD 2,055.00 |
|
TP302336 | Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 |
USD 439.00 |
|
TP320622 | Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2 |
USD 748.00 |
|
TP721099 | Purified recombinant protein of Human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review