POLR2J2 (POLR2J3) (NM_001097615) Human Mass Spec Standard

CAT#: PH320730

POLR2J3 MS Standard C13 and N15-labeled recombinant protein (NP_001091084)

Product Images

Coomassie blue staining of purified POLR2J3 protein (Cat# TP320730). The protein was produced from HEK293T cells transfected with POLR2J3 cDNA clone (Cat# RC220730) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220730
• Predicted MW: 12.9 kDa
• Protein Sequence:
  Sequence Link

  >RC220730 representing NM_001097615
  Red=Cloning site Green=Tags(s)
  
  MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI
  IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001091084
• RefSeq Size: 1680
• RefSeq ORF: 345
• Synonyms: POLR2J2; RPB11b1; RPB11b2
• Locus ID: 548644
• UniProt ID: Q9GZM3, A0A0B4J2F8
• Cytogenetics: 7q22.1
• Summary: This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. [provided by RefSeq, Jul 2008]
• Protein Pathways: Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase