POLR2J2 (POLR2J3) (NM_001097615) Human Mass Spec Standard
CAT#: PH320730
POLR2J3 MS Standard C13 and N15-labeled recombinant protein (NP_001091084)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220730 |
Predicted MW | 12.9 kDa |
Protein Sequence |
>RC220730 representing NM_001097615
Red=Cloning site Green=Tags(s) MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001091084 |
RefSeq Size | 1680 |
RefSeq ORF | 345 |
Synonyms | POLR2J2; RPB11b1; RPB11b2 |
Locus ID | 548644 |
UniProt ID | Q9GZM3, A0A0B4J2F8 |
Cytogenetics | 7q22.1 |
Summary | This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. [provided by RefSeq, Jul 2008] |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420403 | POLR2J3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY420403 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide J3 (POLR2J3) |
USD 396.00 |
|
TP320730 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide J3 (POLR2J3) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review