CHI3L2 (NM_001025197) Human Mass Spec Standard

CAT#: PH320858

CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020368)

Product Images

Coomassie blue staining of purified CHI3L2 protein (Cat# TP320858). The protein was produced from HEK293T cells transfected with CHI3L2 cDNA clone (Cat# RC220858) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220858
• Predicted MW: 42.3 kDa
• Protein Sequence:
  Sequence Link

  >RC220858 representing NM_001025197
  Red=Cloning site Green=Tags(s)
  
  MGATTMDQKSLWAGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVM
  LYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQK
  ENTHFTVLIHELAEAFQKDFTKSTKERLLLTVGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEK
  PLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAETTVGAPASGPG
  AAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLKNLNLGGAMIW
  SIDMDDFTGKSCNQGPYPLVQAVKRSLGSL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001020368
• RefSeq Size: 1456
• RefSeq ORF: 1140
• Synonyms: CHIL2; YKL-39; YKL39
• Locus ID: 1117
• UniProt ID: Q15782
• Cytogenetics: 1p13.2
• Summary: 'The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]'