BUB3 (NM_001007793) Human Mass Spec Standard

CAT#: PH320961

BUB3 MS Standard C13 and N15-labeled recombinant protein (NP_001007794)

Product Images

Coomassie blue staining of purified BUB3 protein (Cat# TP320961). The protein was produced from HEK293T cells transfected with BUB3 cDNA clone (Cat# RC220961) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220961
• Predicted MW: 36.8 kDa
• Protein Sequence:
  Sequence Link

  >RC220961 representing NM_001007793
  Red=Cloning site Green=Tags(s)
  
  MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPTHA
  WSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWDPRTPCNAGTFSQPEKV
  YTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLDP
  SPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIA
  SLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKST
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001007794
• RefSeq Size: 1432
• RefSeq ORF: 978
• Synonyms: BUB3L; hBUB3
• Locus ID: 9184
• UniProt ID: O43684, A0A140VJF3
• Cytogenetics: 10q26.13
• Summary: This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle