SLAMF7 (NM_021181) Human Mass Spec Standard

CAT#: PH320985

SLAMF7 MS Standard C13 and N15-labeled recombinant protein (NP_067004)

Product Images

Coomassie blue staining of purified SLAMF7 protein (Cat# TP320985). The protein was produced from HEK293T cells transfected with SLAMF7 cDNA clone (Cat# RC220985) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220985
• Predicted MW: 37.2 kDa
• Protein Sequence:
  Sequence Link

  >RC220985 representing NM_021181
  Red=Cloning site Green=Tags(s)
  
  MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTI
  IVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSN
  KNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPIL
  ARKLCEGAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGE
  NTEYDTIPHTNRTILKEDPANTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067004
• RefSeq Size: 2672
• RefSeq ORF: 1005
• Synonyms: 19A; CD319; CRACC; CS1
• Locus ID: 57823
• UniProt ID: Q9NQ25
• Cytogenetics: 1q23.3
• Summary: Isoform 3 does not mediate any NK cell activation. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane